Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0103500_circ_g.6 |
| ID in PlantcircBase | osa_circ_029290 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 230887-231779 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0103500 |
| Parent gene annotation |
Similar to Acyl-coenzyme A oxidase 1, peroxisomal (EC 1.3.3.6) ( AOX 1) (Long- chain acyl-CoA oxidase) (AtCX1). (Os06t0103500-01) ;Similar to Acyl-coenzyme A oxidase 1, peroxisomal (EC 1.3.3.6) (AOX 1) (Long- chain acyl-CoA oxidase) (AtCX1). (Os06t0103500-02 );Similar to Acyl-CoA dehydrogenase (Fragment). (Os06t0103500-03 );Similar to predicted protein. (Os06t0103500-04) |
| Parent gene strand | + |
| Alternative splicing | Os06g0103500_circ_g.4 Os06g0103500_circ_g.5 Os06g0103500_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0103500-04:4 Os06t0103500-02:4 Os06t0103500-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.315778639 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
231198-230932(+) 230927-231716(-) |
| Potential amino acid sequence |
MKTVSQLASGKQPVGTTAYMGNIQYLMQCKCGVNTAEDWLNPAAIREVFEARALRMAVNCAQNI NKAPSQEEGFYELSPDLLEVAVAHIQLIIVTKMELKNAENSVVDMVT*(+) MSTTEFSAFFNSILVTIINWIWATATSSRSGDSS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |