Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0106000_circ_g.4 |
ID in PlantcircBase | osa_circ_010283 |
Alias | NA, |
Organism | Oryza sativa |
Position | chr12: 322211-322625 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI-long |
Parent gene | Os12g0106000 |
Parent gene annotation |
Ferritin, Iron storage protein, Iron homeostasis (Os12t0106000-0 1) |
Parent gene strand | - |
Alternative splicing | Os12g0106000_circ_g.1 Os12g0106000_circ_g.2 Os12g0106000_circ_g.3 |
Support reads | 3 |
Tissues | shoot, root, leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0106000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010202 osi_circ_009318 |
PMCS | 0.377069679 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
322237-322425(+) 322414-322411(-) 322224-322577(-) |
Potential amino acid sequence |
MVELCQGCDDGLEPHPASTHVLVLHEFLCVIPLLIAGFFEEFGESLESNVVTVKVGEKGVVRVR CIELHTYKASPFSGWSNSVKGVTMDWSRTLPPRMFWYFMSFSA*(+) MKYQNMRGGRVRLQSIVTPLTEFDHPEKGDALYVWSSMHRTRTTPFSPTLTVTTLLSRDSPNSS KNPAMRRGITQRNS*(-) MPCMCGVQCIVRVPLPFRLL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017; this study |