Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G296800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000772 |
| Alias | Chr07:50715066|50715368 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 50715066-50715368 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G296800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 55/35 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.007G296800.1:2 Gorai.007G296800.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.116714164 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
50715357-50715282(-) 50715117-50715282(-) |
| Potential amino acid sequence |
MARLQELQYTVAGGTKVISGVKLSPRSTRAYLKTSLRCKQESLRMKNASPRKSPIGKFPSTARG GKMYGKIARVAVYSSRRDKGNIRRETKS*(-) MLLQGNHQLASFHPLQEVEKCMARLQELQYTVAGGTKVISGVKLSPRSTRAYLKTSLRCKQESL RMKNASPRKSPIGKFPSTARGGKMYGKIARVAVYSSRRDKGNIRRETKS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |