Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G33470_circ_g.1 |
| ID in PlantcircBase | ath_circ_034408 |
| Alias | At_ciR994 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 16103549-16103800 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT4G33470 |
| Parent gene annotation |
Histone deacetylase |
| Parent gene strand | - |
| Alternative splicing | AT4G33470_circ_g.2 AT4G33470_circ_g.3 AT4G33470_circ_g.4 |
| Support reads | 6 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G33470.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.283012323 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16103714-16103551(-) |
| Potential amino acid sequence |
MGFCVFGNVAIAARHAQRTHGLKRIFIIDFDVHHGNGTNDAFTEDPDIFFLSTHQIAASRNSVD PPIGFALIRPPGHHAVPKGPMGFCVFGNVAIAARHAQRTHGLKRIFIIDFDVHHGNGTNDAFTE DPDIFFLSTHQIAASRNSVDPPIGFALIRPPGHHAVPKGPMGFCVFGNVAIAARHAQRTHGLKR IFIIDFDVHHGNGTNDAFTEDPDIFFLSTHQIAASRNSVDPPIGFALIRPPGHHAVPKGPMGFC VFGNVAIAARHAQRTHGLKRIFIIDFDVHHGNGTNDAFTEDPDIFFLSTHQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |