Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G13445_circ_g.3 |
ID in PlantcircBase | ath_circ_021443 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 4380802-4381022 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT3G13445 |
Parent gene annotation |
TATA-box-binding protein 1 |
Parent gene strand | + |
Alternative splicing | AT3G13445_circ_g.1 AT3G13445_circ_g.2 AT3G13445_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G13445.2:2 AT3G13445.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.287650252 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4380820-4381019(+) |
Potential amino acid sequence |
MRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKRFAAVIMRIREPKTTALIFASGKMVCTGA KSEDFSKMAARKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKRFAAVIMRIRE PKTTALIFASGKMVCTGAKSEDFSKMAARK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |