Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0115700_circ_g.4 |
| ID in PlantcircBase | osa_circ_026279 |
| Alias | Os_ciR2443 |
| Organism | Oryza sativa |
| Position | chr5: 856384-857033 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0115700 |
| Parent gene annotation |
Similar to UDP-galactose transporter related protein-like. (Os05 t0115700-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0115700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.284888333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
856437-856386(+) 856999-857019(-) 856439-857027(-) |
| Potential amino acid sequence |
MEIHNQIFYTTMCSCVLSLSGLILQNQMIPAVDFMFRHPDCFYDVIILSSI*(+) MTKHKVHSWNHLILENKSAQTKNTGAHCRVEYLIVYFHVIPFKEFILEGACETIKYWIGL*(-) MSYPLKSLSWKVLVKPSNTG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |