Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0234100_circ_g.1 |
| ID in PlantcircBase | osa_circ_030317 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 6981663-6981862 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0234100 |
| Parent gene annotation |
Peptidase S1C, HrtA/DegP2/Q/S family protein. (Os06t0234100-01); Similar to DEGP9 (DEGP PROTEASE 9); serine-type peptidase/ tryps in. (Os06t0234100-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0234100-01:1 Os06t0234100-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.45008075 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6981666-6981668(+) |
| Potential amino acid sequence |
MLTVEDDEFWKGVSPLEFGSLPALQDAVTVVGYPIGGDTISVTSGVVSRIEILSYVHGSTELLG LQQC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |