Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0911900_circ_g.1 |
ID in PlantcircBase | osa_circ_005430 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 39738372-39738552 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0911900 |
Parent gene annotation |
Similar to Uncharacterized ACR, COG1565 family protein. (Os01t09 11900-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 3 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0911900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.312751611 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
39738482-39738386(+) 39738525-39738386(+) |
Potential amino acid sequence |
MPVISTQRETSGSCNGLYTSEPCEQASSW*(+) MVCIPQSLVNKHPVGNQALRGFGNTFDTTPFAASDNLSLTDTFSSFMPVISTQRETSGSCNGLY TSEPCEQASSW*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |