Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G45474_circ_g.5 |
| ID in PlantcircBase | ath_circ_006105 |
| Alias | At_ciR1041, AT1G45474_C4 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 17179610-17179940 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI-full, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI2 |
| Parent gene | AT1G45474 |
| Parent gene annotation |
Photosystem I chlorophyll a/b-binding protein 5, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | AT1G45474_circ_g.1 AT1G45474_circ_g.2 AT1G45474_circ_g.3 AT1G45474_circ_g.4 AT1G45474_circ_g.6 AT1G45474_circ_g.7 AT1G45474_circ_g.8 AT1G45474_circ_g.9 |
| Support reads | 5/20/3 |
| Tissues | leaf/root, leaf, aerial, inflorescences, whole_plant/seedlings |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G45474.2:2 AT1G45474.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.61475063 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17179710-17179937(+) |
| Potential amino acid sequence |
MLGVAGILFTDLLRTTGIRNLPVWYEAGAVKFDFASTKTLIVVQFLLMGLAGDYGFDPLGLGED PESLKWYVQAELVHSRFAMLGVAGILFTDLLRTTGIRNLPVWYEAGAVKFDFASTKTLIVVQFL LMGLAGDYGFDPLGLGEDPESLKWYVQAELVHSRFAMLGVAGILFTDLLRTTGIRNLPVWYEAG AVKFDFASTKTLIVVQFLLMGLAGDYGFDPLGLGEDPESLKWYVQAELVHSRFAMLGVAGILFT DLLRTTGIRNLPVWYEAGAVKFDFASTKTLIVVQFLLM(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Pan et al., 2017;Zhang et al., 2019 |