Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G11960_circ_g.4 |
| ID in PlantcircBase | ath_circ_021134 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 3787456-3787539 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G11960 |
| Parent gene annotation |
Cleavage and polyadenylation specificity factor (CPSF) A subunit protein |
| Parent gene strand | + |
| Alternative splicing | AT3G11960_circ_g.2 AT3G11960_circ_g.3 AT3G11960_circ_g.5 AT3G11960_circ_g.6 |
| Support reads | 3 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GC-AG |
| Number of exons covered | AT3G11960.4:1 AT3G11960.3:1 AT3G11960.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.178572318 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3787520-3787536(+) |
| Potential amino acid sequence |
MLTIDSRFSPIQHVQLSTPGNSRIQLGRMLTIDSRFSPIQHVQLSTPGNSRIQLGRMLTIDSRF SPIQHVQLSTPGNSRIQLGRMLTIDS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |