Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0346400_circ_g.1 |
| ID in PlantcircBase | osa_circ_036823 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 15702400-15702699 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0346400 |
| Parent gene annotation |
Similar to Phosphate starvation regulator protein (Regulatory pr otein of P- starvation acclimation response Psr1). (Os08t0346400 -01);Similar to Phosphate starvation regulator protein (Regulato ry protein of P- starvation acclimation response Psr1). (Os08t03 46400-02);Similar to myb family transcription factor-related pro tein. (Os08t0346400-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0346400-02:2 Os08t0346400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.147778194 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15702687-15702686(+) 15702665-15702462(+) |
| Potential amino acid sequence |
MNKWSFLYFGSSKWNKSISYSSNSRFERESRTKRSTQSTDGSATKIA*(+) MEVQRKLHEQVELLIFWELKVEQIYLLQFQLQI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |