Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d033155_circ_g.2 |
ID in PlantcircBase | zma_circ_006854 |
Alias | zma_circ_0000475 |
Organism | Zea mays |
Position | chr1: 252351406-252357238 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d033155 |
Parent gene annotation |
DUF21 domain-containing protein chloroplastic |
Parent gene strand | - |
Alternative splicing | Zm00001d033155_circ_g.1 Zm00001d033155_circ_g.3 Zm00001d033155_circ_g.4 Zm00001d033155_circ_g.5 Zm00001d033155_circ_g.6 Zm00001d033155_circ_g.7 Zm00001d033155_circ_g.8 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d033155_T003:3 Zm00001d033155_T001:3 Zm00001d033155_T002:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.064530975 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
252357167-252351452(+) 252351526-252357210(-) 252351444-252357185(-) |
Potential amino acid sequence |
MCLHQHQMFHPPALLYSLFSSGFPPVVRWSCSSFLVIFWH*(+) MVALQSYSHTRMITVPCWKMQAVLVPKDDKKGTARPSYYWRKSRRKQAI*(-) MTRKELQDHRTTGGNPEENRLYSKAGGWNI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |