Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0693200_circ_g.4 |
| ID in PlantcircBase | osa_circ_016022 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 28465482-28465557 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0693200 |
| Parent gene annotation |
Similar to Chaperone protein dnaJ. (Os02t0693200-01);Similar to Chaperone protein dnaJ. (Os02t0693200-02);Similar to Chaperone p rotein dnaJ. (Os02t0693200-03) |
| Parent gene strand | - |
| Alternative splicing | Os02g0693200_circ_g.1 Os02g0693200_circ_g.2 Os02g0693200_circ_g.3 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0693200-01:1 Os02t0693200-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.27871875 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28465559-28465537(-) 28465528-28465537(-) |
| Potential amino acid sequence |
MWHPDKHKGDNDVTAKFQEINEAYTDVASRQA*(-) MMSQLNFRRSMKPTQMWHPDKHKGDNDVTAKFQEINEAYTDVASRQA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |