Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0394200_circ_g.1 |
| ID in PlantcircBase | osa_circ_023638 |
| Alias | Os_ciR9317 |
| Organism | Oryza sativa |
| Position | chr4: 19379731-19381026 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os04g0394250 |
| Parent gene annotation |
Hypothetical gene. (Os04t0394250-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0394200-01:8 Os04t0394200-03:8 Os04t0394200-02:8 Os04t0394200-01:8 Os04t0394250-00:6 Os04t0394200-03:8 Os04t0394200-02:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_001062 |
| PMCS | 0.204710269 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19380182-19379734(+) 19381015-19380048(+) |
| Potential amino acid sequence |
MGESVTDGTLANFLKKPGDRVEADEPIAQIETDKVTIDVASPEAGVIEKFIASEGDTVTPGTKV AIISKSAAPAETHVAPSEDSTPKETPPKAEETKPKLEEKSPKAEPPKMPLPPKTSPTEPQLPPK ERERRVPMPRLRKRIANRLKDSQNTFAMLTTFNEVDIL*(+) MKLTYSRPHQELFTCQELQQSTFSSYSNWFPELKAYKKTLLLAKCLSVPTLE*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |