Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d036440_circ_g.2 |
| ID in PlantcircBase | zma_circ_008961 |
| Alias | Zm06circ00030, GRMZM2G134930_C1 |
| Organism | Zea mays |
| Position | chr6: 88671348-88671499 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d036440 |
| Parent gene annotation |
WAT1-related protein |
| Parent gene strand | + |
| Alternative splicing | Zm00001d036440_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d036440_T004:1 Zm00001d036440_T002:1 Zm00001d036440_T003:1 Zm00001d036440_T001:1 Zm00001d036440_T005:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.185961949 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
88671382-88671366(+) 88671447-88671366(+) |
| Potential amino acid sequence |
MTWANKILGPSLVALYNPLQPACSTLLSTMFLGTPIYVGRESLRPA*(+) MLYLALDHVSWNSNLRWKGVVASCLNYAIMTWANKILGPSLVALYNPLQPACSTLLSTMFLGTP IYVGRESLRPA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |