Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d036440_circ_g.2 |
ID in PlantcircBase | zma_circ_008961 |
Alias | Zm06circ00030, GRMZM2G134930_C1 |
Organism | Zea mays |
Position | chr6: 88671348-88671499 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d036440 |
Parent gene annotation |
WAT1-related protein |
Parent gene strand | + |
Alternative splicing | Zm00001d036440_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d036440_T004:1 Zm00001d036440_T002:1 Zm00001d036440_T003:1 Zm00001d036440_T001:1 Zm00001d036440_T005:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.185961949 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
88671382-88671366(+) 88671447-88671366(+) |
Potential amino acid sequence |
MTWANKILGPSLVALYNPLQPACSTLLSTMFLGTPIYVGRESLRPA*(+) MLYLALDHVSWNSNLRWKGVVASCLNYAIMTWANKILGPSLVALYNPLQPACSTLLSTMFLGTP IYVGRESLRPA*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |