Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0565600_circ_g.1 |
ID in PlantcircBase | osa_circ_015081 |
Alias | Os_ciR3749 |
Organism | Oryza sativa |
Position | chr2: 21488500-21489447 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0565600 |
Parent gene annotation |
Similar to Homeodomain leucine zipper protein (Fragment). (Os02t 0565600-01) |
Parent gene strand | - |
Alternative splicing | Os02g0565600_circ_igg.1 EPlOSAG00000018790_circ_ig.1 |
Support reads | 2/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0565600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.117010223 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21489356-21489311(+) 21489432-21489413(-) |
Potential amino acid sequence |
MVTKASLPLRLRLLAECSHQNHVCTSLNSHCLALLFWNQTSTWRGRRLSRLAKSLFCFGVRVLC SLKLSSRNEDCSLDSLNFFLAPPPPLSSSSAAS*(+) MCTRGFDVNTRPADGGAEAGRPSSPSSMQEASTRQQVADQEAADDEDNGGGGARKKLRLSKEQS SFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQNRRARQCEFRDVHTWF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |