Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0565600_circ_g.1 |
| ID in PlantcircBase | osa_circ_015081 |
| Alias | Os_ciR3749 |
| Organism | Oryza sativa |
| Position | chr2: 21488500-21489447 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0565600 |
| Parent gene annotation |
Similar to Homeodomain leucine zipper protein (Fragment). (Os02t 0565600-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0565600_circ_igg.1 EPlOSAG00000018790_circ_ig.1 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0565600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.117010223 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21489356-21489311(+) 21489432-21489413(-) |
| Potential amino acid sequence |
MVTKASLPLRLRLLAECSHQNHVCTSLNSHCLALLFWNQTSTWRGRRLSRLAKSLFCFGVRVLC SLKLSSRNEDCSLDSLNFFLAPPPPLSSSSAAS*(+) MCTRGFDVNTRPADGGAEAGRPSSPSSMQEASTRQQVADQEAADDEDNGGGGARKKLRLSKEQS SFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQNRRARQCEFRDVHTWF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |