Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d014425_circ_g.3 |
ID in PlantcircBase | zma_circ_008472 |
Alias | zma_circ_0002099 |
Organism | Zea mays |
Position | chr5: 46343574-46344336 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d014425 |
Parent gene annotation |
Glycerol-3-phosphate acyltransferase |
Parent gene strand | + |
Alternative splicing | Zm00001d014425_circ_g.1 Zm00001d014425_circ_g.2 Zm00001d014425_circ_igg.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d014425_T017:3 Zm00001d014425_T014:3 Zm00001d014425_T003:3 Zm00001d014425_T012:3 Zm00001d014425_T004:3 Zm00001d014425_T018:3 Zm00001d014425_T007:2 Zm00001d014425_T001:3 Zm00001d014425_T015:3 Zm00001d014425_T013:2 Zm00001d014425_T002:3 Zm00001d014425_T016:3 Zm00001d014425_T011:3 Zm00001d014425_T008:3 Zm00001d014425_T009:2 Zm00001d014425_T005:3 Zm00001d014425_T006:3 Zm00001d014425_T010:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.144248474 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
46343644-46343612(+) 46344300-46344041(+) 46344083-46344317(-) |
Potential amino acid sequence |
MVPGQAPFDSSAVDNMRRLLEHAGVPGHIYPLSLLCYEVMPPPQQVEKEIGEQRVISFHGAGLS VTEEINYGDITAHTKNADEWWFTVNLDCTEWW*(+) METLLLIPRMLMSGGSQLIWIAPSGGRDRPNPSSGEWYPGRHHSIHLQWTI*(+) MCPGTPACSRSLLILSTADESNGACPGTILLMRDLGGLYHHSVQSKLTVNHHSSAFLV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |