Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0524525_circ_g.1 |
| ID in PlantcircBase | osa_circ_028592 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 26116040-26116305 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ie-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0524525 |
| Parent gene annotation |
Hypothetical protein. (Os05t0524525-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0524500-01:1 Os05t0524525-00:1 Os05t0524500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.226192888 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26116043-26116042(+) 26116119-26116122(-) |
| Potential amino acid sequence |
MSNSVKPQNETVSNVSSNGGYGHSSSLQLKNRRFTYNELEKITNNFQRVLGRGGFGYVYDGFLE DGTQVAVKLRSESSNQGAKEFLAEQ*(+) MNYARIRHLTTHCSLSHFVASQNCSLLREELLSTLIGRFRPQFHCHLSAILQEAVVNVPKPSTA KHPLEVVRYLLKFIVRKSTILKL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |