Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0134000_circ_g.4 |
| ID in PlantcircBase | osa_circ_026455 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 1976508-1976866 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0134000 |
| Parent gene annotation |
Similar to Glycogen synthase kinase. (Os05t0134000-01);Similar t o Shaggy-related protein kinase eta (EC 2.7.1.-) (ASK-eta) (BRAS SINOSTEROID-INSENSITIVE 2) (ULTRACURVATA1). (Os05t0134000-03) |
| Parent gene strand | - |
| Alternative splicing | Os05g0134000_circ_g.3 Os05g0134000_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0134000-03:2 Os05t0134000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.112118199 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1976801-1976830(-) 1976535-1976823(-) |
| Potential amino acid sequence |
MASVGVVRSSLGFQNETSTSGDADRLPNEMSNMSIRDDNKDIDDIVVNGNGTEPGHVIVTSIDG RNGQAKQVDQLQLIFRKAS*(-) MEEMDRLNRWINYNSSLGKPLEH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |