Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G59900_circ_g.2 |
ID in PlantcircBase | ath_circ_008094 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 22053058-22053383 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | AT1G59900 |
Parent gene annotation |
Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondri al |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G59900.2:2 AT1G59900.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.317773494 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22053067-22053380(+) |
Potential amino acid sequence |
MDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIERIKKLVLSHDLATEKELKDMEKEIRKEVD DAIAKAKILEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIERIKKLVLSHDLATEKELKD MEKEIRKEVDDAIAKAKILEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIERIKKLVLSH DLATEKELKDMEKEIRKEVDDAIAKAKILEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPI ERIKKLVLSHDLATEKELKDMEKEIRKEVDDAIAKAK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |