Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.010G239900_circ_g.1 |
| ID in PlantcircBase | gra_circ_001167 |
| Alias | Chr10:60948595|60948826 |
| Organism | Gossypium raimondii |
| Position | chrChr10: 60948595-60948826 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.010G239900 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 5/21 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.010G239900.1:2 Gorai.010G239900.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000312* gar_circ_000327* |
| PMCS | 0.177441523 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
60948775-60948817(-) 60948632-60948600(+) |
| Potential amino acid sequence |
MNRRNHEDMNLFAIIMNQEIRRLSKQVVS*(-) MAKRFMSSWFLLFINFNSISSAAPKMDLRNNLL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |