Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | orai.010G239900_circ_g.1 |
ID in PlantcircBase | gra_circ_001167 |
Alias | Chr10:60948595|60948826 |
Organism | Gossypium raimondii |
Position | chrChr10: 60948595-60948826 JBrowse» |
Reference genome | Graimondii_221 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Gorai.010G239900 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 5/21 |
Tissues | leaf/ovule |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Gorai.010G239900.1:2 Gorai.010G239900.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | ghi_circ_000312* gar_circ_000327* |
PMCS | 0.177441523 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
60948775-60948817(-) 60948632-60948600(+) |
Potential amino acid sequence |
MNRRNHEDMNLFAIIMNQEIRRLSKQVVS*(-) MAKRFMSSWFLLFINFNSISSAAPKMDLRNNLL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zhao et al., 2017b |