Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0279900_circ_g.3 |
ID in PlantcircBase | osa_circ_001332 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 9934401-9934672 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0279900 |
Parent gene annotation |
Similar to Transcription factor TGA6 (AtbZIP45). Splice isoform 2. (Os01t0279900-01) |
Parent gene strand | + |
Alternative splicing | Os01g0279900_circ_g.1 Os01g0279900_circ_g.2 Os01g0279900_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0279900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.374692218 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9934419-9934466(+) |
Potential amino acid sequence |
MEYARWLEEHNRQINELRSAVNAHAGDNELRGVVDKIMSHYEEIFKQKGNAAKADVFHVLSGMW KTPAERCFLWLGGFRPSELLKGHWLLIWSMHVGWKNTIGKLMS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |