Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0577000_circ_g.1 |
ID in PlantcircBase | osa_circ_012099 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 23832972-23833783 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0577000 |
Parent gene annotation |
Similar to Targeting protein for Xklp2 containing protein, expre ssed. (Os12t0577000-00) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0577000-00:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.120290456 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23832985-23832984(+) 23833073-23833383(-) |
Potential amino acid sequence |
MKEESLVQRMKNKLLEEERLRNPVAQGLPWTTDVPENPVKPLGKEPTEPIDVVLHSEIRSVGRA RFDHQVAERNSFLEKLNMERERQQKLDEELEIKQLRKEQVPRAHPMPDFSKPFVPKREEGR*(+ ) MGDLARPGCAASLPPAACSSFSEPSSPLSSSLFSFRHKRLGKIRHWMRSWHLLLPQLLNLKLFI QLLLPLPLHVQFLQEAVTFGHLVIEPGATDRANLAM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |