Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0567600_circ_g.8 |
| ID in PlantcircBase | osa_circ_020495 |
| Alias | Os_ciR8639 |
| Organism | Oryza sativa |
| Position | chr3: 20517293-20517433 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os03g0567600 |
| Parent gene annotation |
Glycosyltransferase AER61, uncharacterized domain containing pro tein. (Os03t0567600-01);Glycosyltransferase AER61, uncharacteriz ed domain containing protein. (Os03t0567600-02);Similar to Glyco syltransferase. (Os03t0567600-03) |
| Parent gene strand | - |
| Alternative splicing | Os03g0567600_circ_g.9 Os03g0567600_circ_g.10 Os03g0567600_circ_g.11 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0568000-00:1 Os03t0568000-00:1 Os03t0567600-01:1 Os03t0567600-03:1 Os03t0567600-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.107565012 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20517331-20517430(+) 20517405-20517295(-) |
| Potential amino acid sequence |
MNCVIGNCWEGDFMLLLRVFALLVIPFTLPVSSTAFLLGIFSVLSSIMNCVIGNCWEGDFMLLL RVFALLVIPFTLPVSSTAFLLGIFSVLSSIMNCVIGNCWEGDFMLLLRVFALLVIPFTLPVSST AFLLGIFSVLSSIMNCVIGNCWEGDFMLLLRVFALLVIPFTLPVSST(+) MTRRANTRSRSIKSPSQQFPITQFMMLLRTLKMPSKKAVEETGRVKGMTRRANTRSRSIKSPSQ QFPITQFMMLLRTLKMPSKKAVEETGRVKGMTRRANTRSRSIKSPSQQFPITQFMMLLRTLKMP SKKAVEETGRVKGMTRRANTRSRSIKSPSQQFPITQFMMLLRTLKMPSKK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |