Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G171800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000948 |
| Alias | Chr09:13281126|13282904 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 13281126-13282904 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G171800 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.009G171800.2:7 Gorai.009G171800.9:7 Gorai.009G171800.1:7 Gorai.009G171800.11:6 Gorai.009G171800.7:7 Gorai.009G171800.6:7 Gorai.009G171800.3:7 Gorai.009G171800.5:7 Gorai.009G171800.10:7 Gorai.009G171800.4:7 Gorai.009G171800.8:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.117652581 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13282868-13281160(+) 13281151-13282681(-) |
| Potential amino acid sequence |
MYCGIVHCIVLLGYNSKREGIWPV*(+) MPSLLLLYPKSTIQWTIPQYIGSWYPCYEEDDSQEPDPNTFSFDPCCSNSYDIP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |