Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G14610_circ_g.4 |
ID in PlantcircBase | ath_circ_002540 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 5009012-5009342 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G14610 |
Parent gene annotation |
Valine--tRNA ligase, mitochondrial 1 |
Parent gene strand | - |
Alternative splicing | AT1G14610_circ_g.1 AT1G14610_circ_g.2 AT1G14610_circ_g.3 AT1G14610_circ_g.5 AT1G14610_circ_g.6 AT1G14610_circ_g.7 AT1G14610_circ_g.8 AT1G14610_circ_g.9 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G14610.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.191143353 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5009313-5009014(-) |
Potential amino acid sequence |
MDTVLATVKCMRALRAGLLEKQKNERLPAFALCENNVTSEIVKSHELEIRTLANLSSLENWSNE KVESEMDTVLATVKCMRALRAGLLEKQKNERLPAFALCENNVTSEIVKSHELEIRTLANLSSLE NWSNEKVESEMDTVLATVKCMRALRAGLLEKQKNERLPAFALCENNVTSEIVKSHELEIRTLAN LSSLENWSNEKVESEMDTVLATVKCMRALRAGLLEKQKNERLPAFALCENNVTSEIVKSHELEI RTLANLSSLE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |