Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0624000_circ_g.2 |
| ID in PlantcircBase | osa_circ_002756 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 24919361-24919832 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os01g0624000 |
| Parent gene annotation |
Neutral/alkaline nonlysosomal ceramidase family protein. (Os01t0 624000-01);Neutral/alkaline nonlysosomal ceramidase family prote in. (Os01t0624000-02);Similar to Neutral ceramidase. (Os01t06240 00-03);Similar to Neutral ceramidase. (Os01t0624000-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 24 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0624000-02:2 Os01t0624000-04:2 Os01t0624000-01:2 Os01t0624000-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010360 |
| PMCS | 0.345283969 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24919635-24919826(-) 24919373-24919826(-) |
| Potential amino acid sequence |
MGFAFAAGTTDGPGAFDFRQGDVKGNPFWKLVRNLLKTPGKDQVECHSPKPILLDTGEMKEPYD WAIP*(-) MIGRYPDEFESTRVIGNRQFLKARDLFDSASEEIQGKIDYRHTYLDFSKLEVKVSTSAGGQQTV KTCPAAMGFAFAAGTTDGPGAFDFRQGDVKGNPFWKLVRNLLKTPGKDQVECHSPKPILLDTGE MKEPYDWAIP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |