Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d031231_circ_g.2 |
ID in PlantcircBase | zma_circ_006691 |
Alias | Zm01circ00112, GRMZM2G151236_C1 |
Organism | Zea mays |
Position | chr1: 182823438-182823966 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d031231 |
Parent gene annotation |
Protein kinase superfamily protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d031231_T053:2 Zm00001d031231_T016:2 Zm00001d031231_T031:2 Zm00001d031231_T025:2 Zm00001d031231_T028:2 Zm00001d031231_T023:3 Zm00001d031231_T022:3 Zm00001d031231_T012:2 Zm00001d031231_T026:2 Zm00001d031231_T052:3 Zm00001d031231_T008:2 Zm00001d031231_T056:2 Zm00001d031231_T017:3 Zm00001d031231_T033:3 Zm00001d031231_T001:2 Zm00001d031231_T010:2 Zm00001d031231_T014:2 Zm00001d031231_T032:2 Zm00001d031231_T015:3 Zm00001d031231_T024:2 Zm00001d031231_T037:2 Zm00001d031231_T006:3 Zm00001d031231_T054:3 Zm00001d031231_T029:2 Zm00001d031231_T057:2 Zm00001d031231_T021:3 Zm00001d031231_T005:2 Zm00001d031231_T055:2 Zm00001d031231_T050:2 Zm00001d031231_T030:2 Zm00001d031231_T013:2 Zm00001d031231_T007:2 Zm00001d031231_T011:3 Zm00001d031231_T027:2 Zm00001d031231_T036:2 Zm00001d031231_T047:2 Zm00001d031231_T039:2 Zm00001d031231_T002:2 Zm00001d031231_T020:2 Zm00001d031231_T034:2 Zm00001d031231_T004:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.21195321 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
182823915-182823932(+) 182823813-182823924(-) |
Potential amino acid sequence |
MCCYDFVMAIQQFSEPVSSILSGLISQCKTLQFFRCFRAMKSCFEYALTAVSLSPILRPNFFKT SRRFILRDSKTKQRWFRYMKLEINRTQWRLSSRSTLASFSSIETSCLPALYIVSLLRIILIATS SGSSLLALRSFARTTFENTPFPCAAMIS*(+) MYKAGKQEVSILEKLASVDREDKRHCVRFISSFMYRNHLCLVFESLNMNLREVLKKFGRNIGLK LTAVRAYSKQLFIALKHLKNCKVLHCDIKPDNMLLTGSENCWMAITKS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |