Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d019627_circ_g.1 |
ID in PlantcircBase | zma_circ_009265 |
Alias | zma_circ_0002719 |
Organism | Zea mays |
Position | chr7: 46616074-46616395 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d019627 |
Parent gene annotation |
ABC transporter B family member 28 |
Parent gene strand | + |
Alternative splicing | Zm00001d019627_circ_g.2 Zm00001d019627_circ_g.3 Zm00001d019627_circ_g.4 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d019627_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.194360637 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
46616114-46616104(+) |
Potential amino acid sequence |
MESCKHAYQTVHQRHFQLFVLFDHLVVKNDKFLCLTICYFQEVNCSHF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |