Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0358400_circ_g.3 |
| ID in PlantcircBase | osa_circ_027566 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 17015644-17015875 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0358400 |
| Parent gene annotation |
Butirosin biosynthesis, BtrG-like domain containing protein. (Os 05t0358400-01);Similar to predicted protein. (Os05t0358400-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0358400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.3012287 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17015718-17015656(+) 17015846-17015646(-) |
| Potential amino acid sequence |
MRSQHSSRGSMSLGFLRSSQA*(+) MNAGTSSSFISNTVTTISSPSHGSTLKLENSARNLNSCSLSMNAGTSSSFISNTVTTISSPSHG STLKLENSARNLNSCSLSMNAGTSSSFISNTVTTISSPSHGSTLKLENSARNLNSCSLSMNAGT SSSFISNTVTTISSPSHGSTLKLEN(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |