Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0444800_circ_g.1 |
| ID in PlantcircBase | osa_circ_023971 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 22183131-22183810 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os04g0444800 |
| Parent gene annotation |
Ferric reductase-like transmembrane component family protein. (O s04t0444800-01);Ferric reductase-like transmembrane component fa mily protein. (Os04t0444800-02) |
| Parent gene strand | + |
| Alternative splicing | Os04g0444800_circ_g.2 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0444800-02:2 Os04t0444800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.123557868 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22183744-22183209(+) 22183224-22183803(-) |
| Potential amino acid sequence |
MTYYAVESVSLISKFGQISLTYREYFPRIQRADSDRRGSGVRLHLRLPE*(+) MDMVTREGGDVDVRQSRDDQNRRAECEENTPCK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |