Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA022638_circ_g.4 |
ID in PlantcircBase | osi_circ_006633 |
Alias | 6:9069166|9069839 |
Organism | Oryza sativa ssp. indica |
Position | chr6: 9069166-9069839 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA022638 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA022638_circ_igg.1 BGIOSGA022638_circ_g.1 BGIOSGA022638_circ_g.2 BGIOSGA022638_circ_g.3 BGIOSGA022638_circ_g.5 BGIOSGA022638_circ_g.6 BGIOSGA022638_circ_g.7 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA022638-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9069202-9069808(-) 9069174-9069207(+) |
Potential amino acid sequence |
MKPANASRSSGTCRGVPVNNSL*(-) MNGLRWLVSLYNNNLNGILADEMGLGKTVQVISLLCYLMETKNDRGPFLVVVPSSVLPGWESEL NFWAPSINKIAYAGPPEERRKLFKEMIVHQKFNVLLTTYEYLMNKHDRPKLSKIQWHYIIIDEG HRIKNASCKLNADLKHYRSSHRLLLTGTPLQVPDERLALAGFIVQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |