Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d048095_circ_g.1 |
ID in PlantcircBase | zma_circ_010070 |
Alias | Zm09circ00069, zma_circ_0003067, ZmciR379 |
Organism | Zea mays |
Position | chr9: 150075347-150077386 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d048095 |
Parent gene annotation |
DExH-box ATP-dependent RNA helicase DExH14 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d048095_T003:7 Zm00001d048095_T007:7 Zm00001d048095_T042:7 Zm00001d048095_T019:7 Zm00001d048095_T006:7 Zm00001d048095_T001:7 Zm00001d048095_T026:7 Zm00001d048095_T009:7 Zm00001d048095_T031:7 Zm00001d048095_T017:7 Zm00001d048095_T036:7 Zm00001d048095_T002:7 Zm00001d048095_T038:7 Zm00001d048095_T040:7 Zm00001d048095_T043:7 Zm00001d048095_T004:7 Zm00001d048095_T028:6 Zm00001d048095_T016:7 Zm00001d048095_T033:7 Zm00001d048095_T041:7 Zm00001d048095_T005:7 Zm00001d048095_T023:7 Zm00001d048095_T022:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.159853499 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
150075789-150076088(+) |
Potential amino acid sequence |
MSFLYGTMSGNVPYPVDQHHLDDPHVKANLLFQAHFSRAELPISDYVTDLKSVLDQSIRIIQAM IDVCANSGWLTSALTCMHLLQMIIQGLWFERDYESLWMLPSMNDDILDHLKSRGVSTVPSLLDL SREELRRVLQPFSASELYQDLQHFPHVDVKVKLHNEQERSKPPTLNIRLQLKNSRRSASRAFAP RFPKVVNPAYYGLEDTETNTLNSYLSRLVETTFEDLEDSGCIKVDDHSVKYLILGKIASQYYLS YLTVSMFGSNIGPNTTLEVFLHILSAASEFDELPVRHNERKCPVSS*(+) |
Sponge-miRNAs | zma-miR172c-5p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |