Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0834000_circ_g.1 |
| ID in PlantcircBase | osa_circ_017399 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 35884568-35884633 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0834000 |
| Parent gene annotation |
Rac-like GTP-binding protein 5. (Os02t0834000-01);Similar to Rop 4 small GTP binding protein. (Os02t0834000-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0834000-01:1 Os02t0834000-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.255054167 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35884613-35884608(+) 35884610-35884570(-) |
| Potential amino acid sequence |
MQFKNTARRRAEETHWCSGIH*(+) MYAAAPMSFLSSSPCCVFELHSMYAAAPMSFLSSSPCCVFELHSMYAAAPMSFLSSSPCCVFEL HSMYAAAPMSFLSSS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |