Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0834000_circ_g.1 |
ID in PlantcircBase | osa_circ_017399 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 35884568-35884633 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0834000 |
Parent gene annotation |
Rac-like GTP-binding protein 5. (Os02t0834000-01);Similar to Rop 4 small GTP binding protein. (Os02t0834000-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0834000-01:1 Os02t0834000-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.255054167 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35884613-35884608(+) 35884610-35884570(-) |
Potential amino acid sequence |
MQFKNTARRRAEETHWCSGIH*(+) MYAAAPMSFLSSSPCCVFELHSMYAAAPMSFLSSSPCCVFELHSMYAAAPMSFLSSSPCCVFEL HSMYAAAPMSFLSSS(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |