Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0221500_circ_g.2 |
| ID in PlantcircBase | osa_circ_013907 |
| Alias | Os_ciR1169 |
| Organism | Oryza sativa |
| Position | chr2: 6785715-6786354 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os02g0221500 |
| Parent gene annotation |
Nucleotide-binding, alpha-beta plait domain containing protein. (Os02t0221500-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0221500_circ_g.3 |
| Support reads | 15/33 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0221500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003763* osi_circ_012731 |
| PMCS | 0.463369076 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6786303-6786318(-) |
| Potential amino acid sequence |
MKDKHTKMPRGFGFVTFSDPSVIDKVLEDEHVIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGG LPSSLTEDELREHFSPYGKIVEHQIMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQ NHSPSILRSMGL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |