Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0221500_circ_g.2 |
ID in PlantcircBase | osa_circ_013907 |
Alias | Os_ciR1169 |
Organism | Oryza sativa |
Position | chr2: 6785715-6786354 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | Os02g0221500 |
Parent gene annotation |
Nucleotide-binding, alpha-beta plait domain containing protein. (Os02t0221500-01) |
Parent gene strand | - |
Alternative splicing | Os02g0221500_circ_g.3 |
Support reads | 15/33 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0221500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_003763* osi_circ_012731 |
PMCS | 0.463369076 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6786303-6786318(-) |
Potential amino acid sequence |
MKDKHTKMPRGFGFVTFSDPSVIDKVLEDEHVIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGG LPSSLTEDELREHFSPYGKIVEHQIMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQ NHSPSILRSMGL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |