Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0120300_circ_g.7 |
| ID in PlantcircBase | osa_circ_000158 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 1151529-1151723 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0120300 |
| Parent gene annotation |
Similar to EMB2369 (EMBRYO DEFECTIVE 2369); ATP binding / aminoa cyl-tRNA ligase/ leucine-tRNA ligase/ nucleotide binding. (Os01t 0120300-00) |
| Parent gene strand | - |
| Alternative splicing | Os01g0120300_circ_g.6 Os01g0120300_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0120300-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.447781538 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1151635-1151531(-) |
| Potential amino acid sequence |
MLPLQENQLPLTLPELDDFTPTGTGEPPLTKATDWVNYKLRDWLFARQRYWGEPFPVIYRDDTN EMLPLQENQLPLTLPELDDFTPTGTGEPPLTKATDWVNYKLRDWLFARQRYWGEPFPVIYRDDT NEMLPLQENQLPLTLPELDDFTPTGTGEPPLTKATDWVNYKLRDWLFARQRYWGEPFPVIYRDD TNEMLPLQENQLPLTLPELDDFTPTGTGEPPLTKATDW(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |