Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0178300_circ_g.2 |
ID in PlantcircBase | osa_circ_036128 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 4589654-4589998 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0178300 |
Parent gene annotation |
Protein of unknown function DUF2050, pre-mRNA-splicing factor do main containing protein. (Os08t0178300-01);Hypothetical conserve d gene. (Os08t0178300-02) |
Parent gene strand | + |
Alternative splicing | Os08g0178300_circ_g.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0178300-01:2 Os08t0178300-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.426058744 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4589677-4589679(+) 4589679-4589905(-) |
Potential amino acid sequence |
MLKNRIRWGDPMAHLVKRNDTDLLLEDLGDDEKMKESGFIVPQNIPSHSWLKRGVDPPPNRYGI KPGRHWDGVDRSNGMILSSTPC*(+) MVSSSGSSHCCDPLRPNDDQALCRSGLEEDLHHASASCD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |