Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0178300_circ_g.2 |
| ID in PlantcircBase | osa_circ_036128 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 4589654-4589998 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0178300 |
| Parent gene annotation |
Protein of unknown function DUF2050, pre-mRNA-splicing factor do main containing protein. (Os08t0178300-01);Hypothetical conserve d gene. (Os08t0178300-02) |
| Parent gene strand | + |
| Alternative splicing | Os08g0178300_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0178300-01:2 Os08t0178300-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.426058744 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4589677-4589679(+) 4589679-4589905(-) |
| Potential amino acid sequence |
MLKNRIRWGDPMAHLVKRNDTDLLLEDLGDDEKMKESGFIVPQNIPSHSWLKRGVDPPPNRYGI KPGRHWDGVDRSNGMILSSTPC*(+) MVSSSGSSHCCDPLRPNDDQALCRSGLEEDLHHASASCD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |