Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G53440_circ_g.6 |
| ID in PlantcircBase | ath_circ_007158 |
| Alias | AT1G53440_C1, AT1G53440_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 19948157-19948699 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT1G53440 |
| Parent gene annotation |
Probable LRR receptor-like serine/threonine-protein kinase At1g5 3440 |
| Parent gene strand | + |
| Alternative splicing | 1_circ_ag.3 1_circ_ag.4 1_circ_ag.5 AT1G53430_circ_g.1 AT1G53430_circ_g.2 AT1G53430_circ_g.3 AT1G53430_circ_g.4 1_circ_ag.5 AT1G53430_circ_g.6 AT1G53430_circ_g.7 AT1G53430_circ_g.8 1_circ_ag.9 AT1G53430_circ_g.10 AT1G53430_circ_g.11 1_circ_ag.12 1_circ_ag.13 AT1G53430_circ_g.14 1_circ_ag.15 1_circ_ag.16 AT1G53440_circ_g.1 AT1G53440_circ_g.2 AT1G53440_circ_g.3 AT1G53440_circ_g.4 AT1G53440_circ_g.5 AT1G53440_circ_g.7 AT1G53440_circ_g.8 AT1G53440_circ_g.9 AT1G53440_circ_g.10 AT1G53440_circ_g.11 AT1G53440_circ_g.12 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G53440.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.11847744 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19948210-19948696(+) |
| Potential amino acid sequence |
MTNMERLVLRNCLIREPIPEYIGTSMTMLKLLDLSSNMLNGTIPDTFRSLNAFNFMYLNNNSLT GPVPQFILDSKQNMRITDLRGPTSPFPDLQNMTNMERLVLRNCLIREPIPEYIGTSMTMLKLLD LSSNMLNGTIPDTFRSLNAFNFMYLNNNSLTGPVPQFILDSKQNMRITDLRGPTSPFPDLQNMT NMERLVLRNCLIREPIPEYIGTSMTMLKLLDLSSNMLNGTIPDTFRSLNAFNFMYLNNNSLTGP VPQFILDSKQNMRITDLRGPTSPFPDLQNMTNMERLVLRNCLIREPIPEYIGTSMTMLKLLDLS SNMLNGTIPDTFRSLNAFNFMYLNNNSLTGPVPQFILDSKQN |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |