Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.010G191400_circ_g.1 |
| ID in PlantcircBase | gra_circ_001144 |
| Alias | Chr10:54785485|54785694 |
| Organism | Gossypium raimondii |
| Position | chrChr10: 54785485-54785694 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | u-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.010G191400 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.010G191400.6:1 Gorai.010G191400.2:1 Gorai.010G191400.9:1 Gorai.010G191400.4:1 Gorai.010G191400.7:1 Gorai.010G191400.5:1 Gorai.010G191400.1:1 Gorai.010G191400.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.554885913 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
54785687-54785691(+) |
| Potential amino acid sequence |
MPSLEHNLPDNPFASPTKASGEFLSAFSNAEADRDVSVSASSVNNNWVSSTLLPANNALEIASF NSFNCQMPSLEHNLPDNPFASPTKASGEFLSAFSNAEADRDVSVSASSVNNNWVSSTLLPANNA LEIASFNSFNCQMPSLEHNLPDNPFASPTKASGEFLSAFSNAEADRDVSVSASSVNNNWVSSTL LPANNALEIASFNSFNCQMP(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |