Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Cotton_A_28245_circ_g.1 |
| ID in PlantcircBase | gar_circ_000897 |
| Alias | CA_chr8_BGI-A2_v1.0:47145412|47145887 |
| Organism | Gossypium arboreum |
| Position | chrCA_chr8_BGI-A2_v1.0: 47145412-47145887 JBrowse» |
| Reference genome | BGI-A2_v1.0 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Cotton_A_28245 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 7/20 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Cotton_A_28245:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gra_circ_001106* gra_circ_001107* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
47145813-47145780(+) |
| Potential amino acid sequence |
MRNDIIVPTSNLILYTCILLAYLINLHKNLANFKVASSSKVMGETL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |