Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0266500_circ_g.1 |
ID in PlantcircBase | osa_circ_009035 |
Alias | Os_ciR2827 |
Organism | Oryza sativa |
Position | chr11: 9146399-9147234 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os11g0266500 |
Parent gene annotation |
Similar to NB-ARC domain containing protein, expressed. (Os11t02 66500-01);Conserved hypothetical protein. (Os11t0266500-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 4/2 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0266500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_003104* osi_circ_009489 |
PMCS | 0.324705333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9147105-9146399(+) 9146636-9147200(-) |
Potential amino acid sequence |
MSQKPDMRKILMDLLSQILGNGSPMCFDEQRLIDKLREFLKDKS*(+) MPALSTHSPRPSIEHQARPALHVSAAQPPCWVAPFAGTSHPFPHFCALYTLCPARWRASQAESS SPPLKLKPLLPPSSSSYLLGTPEACQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |