Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0266500_circ_g.1 |
| ID in PlantcircBase | osa_circ_009035 |
| Alias | Os_ciR2827 |
| Organism | Oryza sativa |
| Position | chr11: 9146399-9147234 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os11g0266500 |
| Parent gene annotation |
Similar to NB-ARC domain containing protein, expressed. (Os11t02 66500-01);Conserved hypothetical protein. (Os11t0266500-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0266500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003104* osi_circ_009489 |
| PMCS | 0.324705333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9147105-9146399(+) 9146636-9147200(-) |
| Potential amino acid sequence |
MSQKPDMRKILMDLLSQILGNGSPMCFDEQRLIDKLREFLKDKS*(+) MPALSTHSPRPSIEHQARPALHVSAAQPPCWVAPFAGTSHPFPHFCALYTLCPARWRASQAESS SPPLKLKPLLPPSSSSYLLGTPEACQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |