Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0770000_circ_g.1 |
ID in PlantcircBase | osa_circ_004079 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 32476672-32477098 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0770000 |
Parent gene annotation |
Uncharacterised protein family UPF0089 domain containing protein . (Os01t0770000-01) |
Parent gene strand | - |
Alternative splicing | Os01g0769900_circ_igg.1 Os01g0770000_circ_ag.1 Os01g0770000_circ_ag.2 Os01g0770000_circ_g.3 Os01g0770000_circ_ag.4 Os01g0770000_circ_ag.5 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0770000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.547556152 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32477023-32476711(+) 32476803-32476673(+) 32477095-32477068(-) |
Potential amino acid sequence |
MQACGWPQIDKEDRSQTYILVSVHVTLSPKSLRITSAAK*(+) MKNGRIMKPSAFPHFTSSSLPELIISTYACRLVVGLKLTRRIDLKRISSSVSMSP*(+) MDTDEDIRLRSILLVNLRPTTSLHAYVDMINSGREDEVKWGNALGFIILPFFIGVHKDPLDYVR KAKKVVDRKKSSLEVVFTHLAAEVILKLFGLKVTWTLTRIYV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |