Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0770000_circ_g.1 |
| ID in PlantcircBase | osa_circ_004079 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 32476672-32477098 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0770000 |
| Parent gene annotation |
Uncharacterised protein family UPF0089 domain containing protein . (Os01t0770000-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0769900_circ_igg.1 Os01g0770000_circ_ag.1 Os01g0770000_circ_ag.2 Os01g0770000_circ_g.3 Os01g0770000_circ_ag.4 Os01g0770000_circ_ag.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0770000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.547556152 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32477023-32476711(+) 32476803-32476673(+) 32477095-32477068(-) |
| Potential amino acid sequence |
MQACGWPQIDKEDRSQTYILVSVHVTLSPKSLRITSAAK*(+) MKNGRIMKPSAFPHFTSSSLPELIISTYACRLVVGLKLTRRIDLKRISSSVSMSP*(+) MDTDEDIRLRSILLVNLRPTTSLHAYVDMINSGREDEVKWGNALGFIILPFFIGVHKDPLDYVR KAKKVVDRKKSSLEVVFTHLAAEVILKLFGLKVTWTLTRIYV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |