Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0102900_circ_g.3 |
ID in PlantcircBase | osa_circ_000032 |
Alias | Os01circ00309 |
Organism | Oryza sativa |
Position | chr1: 169751-169909 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os01g0102900 |
Parent gene annotation |
Light-regulated protein, Regulation of light-dependent attachmen t of LEAF-TYPE FERREDOXIN-NADP+ OXIDOREDUCTASE (LFNR) to the thy lakoid membrane (Os01t0102900-01) |
Parent gene strand | - |
Alternative splicing | Os01g0102850_circ_ag.1 Os01g0102900_circ_g.1 Os01g0102900_circ_g.2 Os01g0102900_circ_g.4 |
Support reads | 18 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0102900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.231069392 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
169901-169753(-) |
Potential amino acid sequence |
MEACDLIGGEACNVQMYPEAKLSSSAAVAVSRAAAEEVDRDYLSYDEPTTVFPMEACDLIGGEA CNVQMYPEAKLSSSAAVAVSRAAAEEVDRDYLSYDEPTTVFPMEACDLIGGEACNVQMYPEAKL SSSAAVAVSRAAAEEVDRDYLSYDEPTTVFPMEACDLIGGEACNVQMYPEAKLSSSAAVAVSRA AAEEVDRDYLSYDEPT(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |