Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0102900_circ_g.3 |
| ID in PlantcircBase | osa_circ_000032 |
| Alias | Os01circ00309 |
| Organism | Oryza sativa |
| Position | chr1: 169751-169909 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os01g0102900 |
| Parent gene annotation |
Light-regulated protein, Regulation of light-dependent attachmen t of LEAF-TYPE FERREDOXIN-NADP+ OXIDOREDUCTASE (LFNR) to the thy lakoid membrane (Os01t0102900-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0102850_circ_ag.1 Os01g0102900_circ_g.1 Os01g0102900_circ_g.2 Os01g0102900_circ_g.4 |
| Support reads | 18 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0102900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.231069392 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
169901-169753(-) |
| Potential amino acid sequence |
MEACDLIGGEACNVQMYPEAKLSSSAAVAVSRAAAEEVDRDYLSYDEPTTVFPMEACDLIGGEA CNVQMYPEAKLSSSAAVAVSRAAAEEVDRDYLSYDEPTTVFPMEACDLIGGEACNVQMYPEAKL SSSAAVAVSRAAAEEVDRDYLSYDEPTTVFPMEACDLIGGEACNVQMYPEAKLSSSAAVAVSRA AAEEVDRDYLSYDEPT(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |