Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0590800_circ_g.1 |
| ID in PlantcircBase | osa_circ_015207 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 22823403-22823774 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0590800 |
| Parent gene annotation |
Similar to Serine/threonine-protein kinase Nek6. (Os02t0590800-0 0) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0590700-01:1 Os02t0590700-02:1 Os02t0590700-01:1 Os02t0590800-00:3 Os02t0590700-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.186829279 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22823755-22823737(-) |
| Potential amino acid sequence |
MCPEILADIPYGYKSDIWSLGCCMFEILAHRPAFKAADMASLINKINRSSISPMPPIYSSSLLW EPQTTCAQKY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |