Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0590800_circ_g.1 |
ID in PlantcircBase | osa_circ_015207 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 22823403-22823774 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0590800 |
Parent gene annotation |
Similar to Serine/threonine-protein kinase Nek6. (Os02t0590800-0 0) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 3 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0590700-01:1 Os02t0590700-02:1 Os02t0590700-01:1 Os02t0590800-00:3 Os02t0590700-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.186829279 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22823755-22823737(-) |
Potential amino acid sequence |
MCPEILADIPYGYKSDIWSLGCCMFEILAHRPAFKAADMASLINKINRSSISPMPPIYSSSLLW EPQTTCAQKY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |