Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0823000_circ_g.1 |
ID in PlantcircBase | osa_circ_017280 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 35342868-35345168 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0823000 |
Parent gene annotation |
Peptidase A22B, signal peptide peptidase domain containing prote in. (Os02t0823000-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0823050-00:5 Os02t0823050-00:5 Os02t0823000-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.145883869 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35343825-35342868(+) 35343217-35344470(-) |
Potential amino acid sequence |
MVCDRNETDLDINIPAVLLPKDAGNDLQKLLTRGKVSVQLYSPDRPLVDTAEVFLWLMAVGTIL CASYWSAWSAREAVIEQEKLLKDGHESSLNLEAGGSSGMVDINMTSAILFVVIASCFLIMLYKL MSHWFVELLVVIFCIGGVEGLQTCLVALLSR*(+) MIIIAEAPAASAFLAFLVNLQFPLCTNKTSPATFCVGGSQQSIGSANNSPVRLACFSFDSIVGP KRAPTPTNSPSSLLLTQVCTFTLTIKPPSKFADPLHHQCKR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |