Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0199900_circ_g.2 |
| ID in PlantcircBase | osa_circ_013694 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 5597415-5598225 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0199900 |
| Parent gene annotation |
Similar to 26S proteasome regulatory complex subunit p42D. (Os02 t0199900-01);Similar to 26S protease regulatory subunit S10B. (O s02t0199900-02);Similar to 26S protease regulatory subunit S10B. (Os02t0199900-03) |
| Parent gene strand | - |
| Alternative splicing | Os02g0199900_circ_g.1 Os02g0199900_circ_g.3 Os02g0199900_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0199900-03:4 Os02t0199900-02:3 Os02t0199900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003727* |
| PMCS | 0.244241461 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5597928-5597415(+) 5598109-5597446(+) 5598129-5598156(-) |
| Potential amino acid sequence |
MKHVVNHRVHLTWKCAHDCQCCHVKNNTSSRSQFLLVHFAPATNHISGTTASLNNN*(+) MIVSVVMSRTTRVPEVNFSLSTLLRQPTTYLGPLLALTIIDDHVHSQTFP*(+) MTTLTIMRTLPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPELFLRVGIK PPKGVLLYGPPGTGKTLLARAIASNIDANFLKIVSSAIIDKYIGESARLIREMFGYARDHQLLL RLAVVPDMWLVAGAKWTRRN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |