Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0329300_circ_g.6 |
| ID in PlantcircBase | osa_circ_014519 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 13355260-13357100 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0329300 |
| Parent gene annotation |
Conserved hypothetical protein. (Os02t0329300-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0329300_circ_g.3 Os02g0329300_circ_g.4 Os02g0329300_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0329450-00:3 Os02t0329300-01:3 Os02t0329450-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.144333759 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13355441-13355274(+) |
| Potential amino acid sequence |
MDLSSSVPHSELLSARASEASPFLDKQEQMSALFQGKEEALSRLDDRNGRAQQQTVDVAEILRR WTHALQRIHKQSLHLAKANDGDGPELLRSASDGETSTHADSLTATLAEHRQHLVSIQANMRS*( +) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |