Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0622033_circ_g.5 |
| ID in PlantcircBase | osa_circ_002734 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 24815972-24816513 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0622033 |
| Parent gene annotation |
Hypothetical gene. (Os01t0622033-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0622033-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.206641728 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24816050-24816452(-) |
| Potential amino acid sequence |
MDQDERNLASQDFWSFCDAINAGNCSLQKVEGLAQMTLMLLLVFHC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |