Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0264300_circ_g.2 |
ID in PlantcircBase | osa_circ_018994 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 8700119-8700644 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0264150 |
Parent gene annotation |
Hypothetical gene. (Os03t0264150-01) |
Parent gene strand | - |
Alternative splicing | Os03g0264150_circ_g.1 Os03g0264300_circ_g.1 Os03g0264300_circ_g.3 Os03g0264300_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0264300-00:2 Os03t0264300-00:2 Os03t0264150-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.41989935 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8700492-8700150(+) |
Potential amino acid sequence |
MRKHSHALFIVISRPATFYLIRNYFLKLEILDWPSFFLTPLLTLAHVLQEQWKPERWHSNCN*( +) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |