Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0944000_circ_g.2 |
ID in PlantcircBase | osa_circ_005777 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 41492408-41492996 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0944000 |
Parent gene annotation |
Conserved hypothetical protein. (Os01t0944000-01);Hypothetical c onserved gene. (Os01t0944000-02);Conserved hypothetical protein. (Os01t0944000-03) |
Parent gene strand | - |
Alternative splicing | Os01g0944000_circ_g.1 |
Support reads | 2 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0944000-03:3 Os01t0944000-01:3 Os01t0944000-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.231335243 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
41492669-41492924(-) |
Potential amino acid sequence |
MDSIKQCHGPPKLFIRDKYDIRGEGACLKRYTDSSFNTGFACSRMLEPITQRICCTDVLHDMFS SAAGGRVATRGE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |